PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009791625.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 276aa    MW: 30367.8 Da    PI: 6.3074
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009791625.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1262.1e-0890136551
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                     k  +r   N+eA r++R++Kka+ + Le++v  L a N++L k+l+ 
  XP_009791625.1  90 KGKKRPVGNKEAVRKYREKKKARAASLEDEVIRLRAINQQLFKRLQG 136
                     66788899**********************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-1380154No hitNo description
SMARTSM003381.3E-785153IPR004827Basic-leucine zipper domain
PfamPF077162.7E-1387135IPR004827Basic-leucine zipper domain
CDDcd146864.36E-1092145No hitNo description
SuperFamilySSF579593.19E-692135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MMADGELEFS NQEMLSSSNF GEFSSSMDSF FNEILKDTHA CTHAHTCNPP GPDNSHTHTC  60
YHVHTKFVPP SEEDEDKNPS DDTAESSEKK GKKRPVGNKE AVRKYREKKK ARAASLEDEV  120
IRLRAINQQL FKRLQGQAVL EAEVARLKCL LVDIRGRIEG EIGSFPYQKP MKSGNVYQNV  180
VNPNIPGSYV VNSCNLQCDD QVYCLHPGAE VKSSDGTVLN GQGFNNCEFE TLQCLGNQTS  240
GMEEVPCPMD NGTPTPTANT SGRSKRKGGA RTTTAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009791625.10.0PREDICTED: uncharacterized protein LOC104238836
RefseqXP_009791619.10.0PREDICTED: uncharacterized protein LOC104238836
RefseqXP_016513124.10.0PREDICTED: basic leucine zipper 23-like
RefseqXP_016513116.10.0PREDICTED: basic leucine zipper 23-like
SwissprotQ8GTS21e-108BZP23_ARATH; Basic leucine zipper 23
TrEMBLK4B4201e-180K4B420_SOLLC; Uncharacterized protein
STRINGSolyc01g111580.2.11e-180(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.14e-91bZIP family protein